PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00101601001
Common NameGSBRNA2T00101601001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ARF
Protein Properties Length: 546aa    MW: 61352 Da    PI: 6.7379
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00101601001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.33e-23116216198
                          EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                          f+k+lt sd++++g +++ +k+a+e+     + +++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   
  GSBRNA2T00101601001 116 FVKILTASDTSTHGGFSVLRKHATEClplldMTQPTPTQELVARDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLIAGDAFVFL-- 203
                          89****************************9666677789************************************************.. PP

                          SSSEE..EEEEE- CS
                   B3  86 grsefelvvkvfr 98 
                          + +++ l+v+v+r
  GSBRNA2T00101601001 204 RGKTGDLRVGVRR 216
                          3488889***998 PP

2Auxin_resp91.71.3e-30242321183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          a+ha++tk++F v+Y+Pr   s+F++ v+k+++a+k+ +s G Rf+m+fe+e+s+er ++G ++g  d++p +W+ SkWr+L+
  GSBRNA2T00101601001 242 ASHAVNTKTMFVVFYKPRI--SQFIIGVNKYMSAMKSGFSTGRRFRMRFEGEESPERVFTGAIIGSGDISP-QWQASKWRLLQ 321
                          789***************8..9***********************************************99.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.1E-38103245IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-37109231IPR015300DNA-binding pseudobarrel domain
CDDcd100176.41E-20115216No hitNo description
SMARTSM010193.0E-21116218IPR003340B3 DNA binding domain
PROSITE profilePS5086312.012116218IPR003340B3 DNA binding domain
PfamPF023623.5E-21116216IPR003340B3 DNA binding domain
PfamPF065071.8E-27242321IPR010525Auxin response factor
PfamPF023092.4E-8417470IPR033389AUX/IAA domain
SuperFamilySSF542774.61E-12424510No hitNo description
PROSITE profilePS5174525.51434526IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MANVEDDHLY MELWKACAGP LVEVPRYGER VFYFPQGHME QLVASTKQEG VVDQEIPDFN  60
LPSKLLCRVL SVLLKAEHET DEVYAQITLQ PEEDQNEPES LDPPVTEAAK QSVDSFVKIL  120
TASDTSTHGG FSVLRKHATE CLPLLDMTQP TPTQELVARD LHGYEWRFKH IFRGQPRRHL  180
LTTGWSTFVT SKRLIAGDAF VFLRGKTGDL RVGVRRLARQ QSTMPASVIS SQSMNLGVLA  240
TASHAVNTKT MFVVFYKPRI SQFIIGVNKY MSAMKSGFST GRRFRMRFEG EESPERVFTG  300
AIIGSGDISP QWQASKWRLL QIQWDEPSLL YKYLLPEITG SPVASNFLSS FPQSHEANPS  360
LKLLFQDPPS GLQCKKTETS VTSCCRLFGF DLMSKPTTTP SPLGKQVISM DSNNSASTKC  420
QDLNSHQKQQ TSTRSRIKVQ MQGTAVGRAV DLTLLRSYDE LISELEKLFE IEGELRPKDK  480
WAIVFTDNEG YMMLAGDDPW NEFCKMAKKL FIYSSDEVKK MSSKSSLDDE GTIINLEPDQ  540
RIANL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-151235412361Auxin response factor 1
4ldw_A1e-151235412361Auxin response factor 1
4ldv_A1e-151235412361Auxin response factor 1
4ldx_B1e-151235412361Auxin response factor 1
4ldx_A1e-151235412361Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00101601001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533630.0AK353363.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-29-L13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013621961.10.0PREDICTED: auxin response factor 11-like isoform X1
SwissprotQ9ZPY60.0ARFK_ARATH; Auxin response factor 11
TrEMBLA0A078E1S40.0A0A078E1S4_BRANA; Auxin response factor
STRINGscaffold_403621.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46530.10.0auxin response factor 11
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]